KCNTATCATQRLANFLVHSSNNFGPILPPTNVGSNTY-NH2 (S-S Bond) acetate salt
Shanghai Apeptide Co.,Ltd is one of famous-peptide manufacturers in China.
For 10 years we have supplied peptides/API pepitdes/Custom Peptide/ Amino acides/ protein etc...
Our website address: www.apeptides.com/en/
We have amyloid peptides libs and supply high quality\competetive price\best service.
We Supply :
Peptide
Custom pepitdes synthesis
Amino acids/Unusual amino acids
Custom amino acid synthesis
Protein expression
We can do:
Custom Peptide Modifications
o Amidation,C-termainal
o Aldehydes,C-termainal
o Alcohols,C-termainal
o pNA (p-Nitroanilide),C-termainal
o AMC,C-termainal
o AFC,C-termainal
o Cysteamide,C-termainal
o Ester,C-termainal
o N-Alkyl Amides,N-termainal
o Acetylated,N-termainal
o Palmytolyl,N-termainal
o HYNIC,N-termainal
o Biotinylated,N-termainal
o Bromoacetylated,N-termainal
o DOTA,DTPA conjugated,N-termainal
o Formylated,N-termainal
o Myristoylated,N-termainal
o Succinylated,N-termainal
Dye-labeled peptides
AFC, AMC, Lys(Dye), pNA, Rh110
N-terminal Modifications
Bodipy-FL, Cy3, Cy5, Texas Red, 5-Tamra, 5-lodoacetamido fluorescein
Rhodamine 110 and Rhodamine B Luciferin, EDANS
FAM, FITC, MCA, Rox, Sulforhodamine 101, 5-TAMRA
Cyclic peptides
o N -> C or Head to Tail o Disulfide (S-S bond formation) .Trisulfide formation)
o Cyclic-natural peptides
Methylated peptides
o Lys(For),Lys(Me), Lys(Me)2, Lys(Me)3, Arg(Me)2 symmetrical, D-Tyr(Me),D-Tyr(Et)
o Na-Methylated(N-Me-Arg,N-Me-Asp, N-Me-Glu, N-Me-Leu, N-Me-Nle, N-Me-Nva, N-Me-Phe, N-Me-S N-Me-Ser, N-Me-Trp, N-Me-Thr, N-Me-Val)
Other modifications
o BSA, KLH conjugated peptides for antibody production )
o Phosphoserine, Phosphothreonine, Phosphotyrosine
o Sulfated Tyrosine or Serine
o MAPS (Multiple Antigenic Peptide)
o Glycopeptides
o PEGylation
o Peptidomimetics