Products Categories
    Product Certification&
    Enterprise Certification

  • Ms.Mayer
    Tel: +86-21-60871011

  • Mobile:(086)17321195801
  • Tel:+86-21-60871011
  • Fax:+86-21-50673982
  • URL:http://www.apeptides.com/en/
  • Province/state:shanghai
  • City:shanghai
  • Street:No. 80 Chuanshan Shuyuan Steet,Pudong,Shanghai
  • MaxCard:
Home > Products >  β-Lipotropin (61-91) (human) (β-Endorphin (human), Lipotropin C Fragment (human))

β-Lipotropin (61-91) (human) (β-Endorphin (human), Lipotropin C Fragment (human))

  • Min.Order: 1 Milligram
  • Payment Terms: T/T
  • Product Details

Keywords

  • β-Lipotropin (61-91) (human) (β-Endorphin (human), Lipotropin C Fragment (human))
  • β-Lipotropin (61-91) (human) (β-Endorphin (human), Lipotropin C Fragment (human))
  • YGGFMTSEKSQTPLVTLFKNAIIKNAYKKGE

Quick Details

  • ProName: β-Lipotropin (61-91) (human) (β-Endorp...
  • Appearance: Whithe powder
  • Application: Research
  • DeliveryTime: quote
  • PackAge: According customer's requirements
  • Port: Shanghai
  • ProductionCapacity: 1-1000 Gram/Day
  • Purity: 95%;98%;99%
  • Storage: keep in dry,cool
  • Transportation: According customer's requirements
  • LimitNum: 1 Milligram
  • Moisture Content: <1%
  • Residual Solvent: <1%
  • Heavy Metal: Null

Superiority

Apeptide Co.,Ltd  (Shanghai ,China) is one of famous-peptide manufacturers in China.
For 10 years we have supplied peptides/API pepitdes/Custom Peptide/ Amino acides/ protein etc...
Our website address:   www.apeptides.com/en/
We have amyloid peptides libs and supply high quality\competetive price\best service.
 
We Supply :
Peptide   
Custom pepitdes synthesis
Amino acids/Unusual amino acids
Custom amino acid synthesis
Protein expression
 
We can do:
Custom Peptide Modifications
         o Amidation,C-termainal
         o Aldehydes,C-termainal
         o Alcohols,C-termainal
         o pNA (p-Nitroanilide),C-termainal
         o AMC,C-termainal
         o AFC,C-termainal
         o Cysteamide,C-termainal
         o Ester,C-termainal
         o N-Alkyl Amides,N-termainal  
         o Acetylated,N-termainal 
         o Palmytolyl,N-termainal 
         o HYNIC,N-termainal 
         o Biotinylated,N-termainal 
         o Bromoacetylated,N-termainal 
         o DOTA,DTPA conjugated,N-termainal 
         o Formylated,N-termainal 
         o Myristoylated,N-termainal 
         o Succinylated,N-termainal 
 Dye-labeled peptides
       AFC, AMC, Lys(Dye), pNA, Rh110 
 N-terminal Modifications
       Bodipy-FL, Cy3, Cy5, Texas Red, 5-Tamra, 5-lodoacetamido fluorescein
       Rhodamine 110 and Rhodamine B Luciferin, EDANS
       FAM, FITC, MCA, Rox, Sulforhodamine 101, 5-TAMRA  
Cyclic peptides
        o N -> C or Head to Tail o Disulfide (S-S bond formation) .Trisulfide formation)
        o Cyclic-natural peptides 
 Methylated peptides
        o Lys(For),Lys(Me), Lys(Me)2, Lys(Me)3, Arg(Me)2 symmetrical, D-Tyr(Me),D-Tyr(Et)
        o Na-Methylated(N-Me-Arg,N-Me-Asp, N-Me-Glu, N-Me-Leu, N-Me-Nle, N-Me-Nva, N-Me-Phe, N-Me-S N-Me-Ser, N-Me-Trp, N-Me-Thr, N-Me-Val)
Other modifications
       o BSA, KLH conjugated peptides for antibody production )
       o Phosphoserine, Phosphothreonine, Phosphotyrosine
       o Sulfated Tyrosine or Serine
       o MAPS (Multiple Antigenic Peptide) 
       o Glycopeptides
       o PEGylation
       o Peptidomimetics
 
 
 
 

Details

we also supply other amyloid peptides products and custom peptides as below:
amyloid β 27-35 human
β-amyloid (11-22)
β-amyloid (25-35)
amyloid β-protein fragment 17-28
amyloid β 28-35 human
amyloid β protein fragment 1-38
β-amyloid (1-42), human
β-amyloid (42-1)
amyloid β-protein (10-20)
amyloid β 13-16 human
β-amyloid (1-33)
β-amyloid (1-40),human
β-amyloid (1-16)
β-amyloid (12-28)
β-amyloid (18-28)
β-amyloid (1-11)
acetyl-amyloid β-protein fragment 15-20 amide
acetyl-amyloid β 25-35
n-me-abz-amyloid β/a4 protein precursor770
amylin, human, amide
amyloid β 16-10 reverse human
amyloid β 17-42 human
amyloid β 26-35 human
β-amyloid (1-28)
[gln11]-amyloid β-protein (1-28)
β-amyloid (1-40), rat
amyloid β-protein fragment 1-43
β-amyloid (1-42), rat
amyloid β-protein fragment 17-40
amyloid β-protein fragment 22-35
amyloid β-protein fragment 35-25
amyloid β-protein fragment 40-1
amyloid precursor protein n-terminal peptide
amyloid protein non-aβ component
[arg13] amyloid-β-protein fragment 1-40
[gln22]-amyloid β 1-40 human
[glp3]-amyloid β 3-42 human
[glu11]-amyloid β 1-16
aftin-4
amyloid β-protein (1-14)
[gln11] -beta- amyloid (1-28)
(cys)-amyloid β-protein (1-40)
(nle3)-amyloid β-protein (25-35)
(asn23)-amyloid β-protein (1-40)
beta- amyloid (1-16)
amyloid p component (27-38) amide
(leu1)-amyloid β-protein (16-19)
amyloid beta-protein (6-20)
(gly22)-amyloid β-protein (1-40)
amyloid β-protein (1-46)
(gly21)-amyloid β-protein (1-40)
(lys22)-amyloid β-protein (1-40)
(gln22)-amyloid β-protein (1-40)
amyloid β-protein (10-35)
amyloid β-protein(30-40)
amyloid β-protein fragment 22-35
amyloid β-protein fragment 25-35
[pglu3]-amyloid β-protein fragment 3-42
amyloid p component (33-38) amide
amyloid beta-protein fragment 1-40
β-amyloid: 33-42
amyloid β-protein fragment 35-25
amyloid β-peptide (10-20) (human)
(val671)-amyloid β/a4 protein precursor770 (667-676)
β-amyloid/a4 protein precusor (app) (319-335)

Other products of this supplier

lookchemhot product CAS New CAS Cas Database Article Data Chemical Catalog