Products Categories
    Product Certification&
    Enterprise Certification

  • Ms.Mayer
    Tel: +86-21-60871011

  • Mobile:(086)17321195801
  • Tel:+86-21-60871011
  • Fax:+86-21-50673982
  • URL:http://www.apeptides.com/en/
  • Province/state:shanghai
  • City:shanghai
  • Street:No. 80 Chuanshan Shuyuan Steet,Pudong,Shanghai
  • MaxCard:
Home > Products >  RVG-9R

RVG-9R CAS NO.1678417-57-6

  • Min.Order: 1 Milligram
  • Payment Terms: T/T
  • Product Details

Keywords

  • RVG-9R
  • 1678417-57-6
  • YTIWMPENPRPGTPCDIFTNSRGKRASNGGGGRRRRRRRRR

Quick Details

  • ProName: RVG-9R
  • CasNo: 1678417-57-6
  • Molecular Formula: C30H49N9O9
  • Appearance: Whithe powder
  • Application: Research
  • DeliveryTime: quote
  • PackAge: According customer's requirements
  • Port: Shanghai
  • ProductionCapacity: 1-1000 Gram/Day
  • Purity: 95%;98%;99%
  • Storage: keep in dry,cool
  • Transportation: According customer's requirements
  • LimitNum: 1 Milligram
  • Moisture Content: <1%
  • Residual Solvent: <1%
  • Heavy Metal: Null

Superiority

Shanghai Apeptide Co.,Ltd is one of famous-peptide manufacturers in China.
For 10 years we have supplied peptides/API pepitdes/Custom Peptide/ Amino acides/ protein etc...
Our website address:   www.apeptides.com/en/
We have amyloid peptides libs and supply high quality\competetive price\best service.
 
We Supply :
Peptide   
Custom pepitdes synthesis
Amino acids/Unusual amino acids
Custom amino acid synthesis
Protein expression
 
We can do:
Custom Peptide Modifications
         o Amidation,C-termainal
         o Aldehydes,C-termainal
         o Alcohols,C-termainal
         o pNA (p-Nitroanilide),C-termainal
         o AMC,C-termainal
         o AFC,C-termainal
         o Cysteamide,C-termainal
         o Ester,C-termainal
         o N-Alkyl Amides,N-termainal  
         o Acetylated,N-termainal 
         o Palmytolyl,N-termainal 
         o HYNIC,N-termainal 
         o Biotinylated,N-termainal 
         o Bromoacetylated,N-termainal 
         o DOTA,DTPA conjugated,N-termainal 
         o Formylated,N-termainal 
         o Myristoylated,N-termainal 
         o Succinylated,N-termainal 
 Dye-labeled peptides
       AFC, AMC, Lys(Dye), pNA, Rh110 
 N-terminal Modifications
       Bodipy-FL, Cy3, Cy5, Texas Red, 5-Tamra, 5-lodoacetamido fluorescein
       Rhodamine 110 and Rhodamine B Luciferin, EDANS
       FAM, FITC, MCA, Rox, Sulforhodamine 101, 5-TAMRA  
Cyclic peptides
        o N -> C or Head to Tail o Disulfide (S-S bond formation) .Trisulfide formation)
        o Cyclic-natural peptides 
 Methylated peptides
        o Lys(For),Lys(Me), Lys(Me)2, Lys(Me)3, Arg(Me)2 symmetrical, D-Tyr(Me),D-Tyr(Et)
        o Na-Methylated(N-Me-Arg,N-Me-Asp, N-Me-Glu, N-Me-Leu, N-Me-Nle, N-Me-Nva, N-Me-Phe, N-Me-S N-Me-Ser, N-Me-Trp, N-Me-Thr, N-Me-Val)
Other modifications
       o BSA, KLH conjugated peptides for antibody production )
       o Phosphoserine, Phosphothreonine, Phosphotyrosine
       o Sulfated Tyrosine or Serine
       o MAPS (Multiple Antigenic Peptide) 
       o Glycopeptides
       o PEGylation
       o Peptidomimetics
 
 
 
 

Details

One Letter Code YTIWMPENPRPGTPCDIFTNSRGKRASNGGGGRRRRRRRRR
Synonyms Rabies Virus Glycoprotein (194-221) Nonaarginine Chimer, Chimeric Rabies Virus Glycoprotein Fragment (RVG-9R)
Molecular Formula C???H???N??O??S?
Relative Molecular Mass 4843.51
CAS Registry Number 1678417-57-6
Source Synthetic
Storage Conditions -20 ± 5 °C
Areas of Interest Cell-permeable Peptides

 

Other products of this supplier

lookchemhot product CAS New CAS Cas Database Article Data Chemical Catalog